From 1be47f76ffb41eafad6650f7ba9d416ace9a121e Mon Sep 17 00:00:00 2001 From: markgeejw <19712422+markgeejw@users.noreply.github.com> Date: Mon, 22 Jun 2026 14:35:14 +0000 Subject: [PATCH] docs: sync API specs from openprotein-api --- source/_static/js/foldSpec.js | 12 +- source/_static/js/predictorSpec.js | 24 +- source/_static/js/promptSpec.js | 1683 ++++++++++++++++++++++++++++ 3 files changed, 1712 insertions(+), 7 deletions(-) create mode 100644 source/_static/js/promptSpec.js diff --git a/source/_static/js/foldSpec.js b/source/_static/js/foldSpec.js index 6f4ec92..67d191b 100644 --- a/source/_static/js/foldSpec.js +++ b/source/_static/js/foldSpec.js @@ -240,7 +240,7 @@ const foldSpec = { tags: ["fold requests", "esmfold2"], summary: "ESMFold2", description: - "Create structure prediction using ESMFold2, an all-atom structure prediction\nmodel. Folds protein/DNA/RNA/ligand complexes, optionally conditioned on an MSA.\n\nArgs:\n - `sequences`: List of chain/molecule entities in the input. Each entry describes a protein, nucleic acid, or ligand, including its sequence, identifier(s), and optional attributes such as msa_id, SMILES string, CCD code.\n - `msa_id` should refer to the id of an msa job which included this protein as a query, or `null` for single sequence mode.\n - `smiles` and `ccd` are mutually exclusive for ligands.\n - `diffusion_samples`: Number of diffusion samples to use. Controls how many independent structure samples are generated per input. Default is 1.\n - `num_steps`: Number of sampling steps to use. Sets the number of steps in the diffusion process for each sample. Default is 200.\n - `num_recycles`: Number of recycling steps to use. Determines how many times the model refines its prediction iteratively. Default is 3.\n - `seed`: Random seed for reproducible sampling. `null` lets the system decide.", + "Create structure prediction using ESMFold2, an all-atom structure prediction\nmodel. Folds protein/DNA/RNA/ligand complexes, optionally conditioned on an MSA.\n\nArgs:\n - `sequences`: List of chain/molecule entities in the input. Each entry describes a protein, nucleic acid, or ligand, including its sequence, identifier(s), and optional attributes such as msa_id, SMILES string, CCD code.\n - `msa_id` should refer to the id of an msa job which included this protein as a query, or `null` for single sequence mode.\n - `smiles` and `ccd` are mutually exclusive for ligands.\n - `diffusion_samples`: Number of diffusion samples to use. Controls how many independent structure samples are generated per input. Default is 1.\n - `num_steps`: Number of sampling steps to use. Sets the number of steps in the diffusion process for each sample. Default is 100.\n - `num_recycles`: Number of recycling steps to use. Determines how many times the model refines its prediction iteratively. Default is 3.\n - `seed`: Random seed for reproducible sampling. `null` lets the system decide.", requestBody: { description: "Request for structure prediction.", content: { @@ -328,7 +328,7 @@ const foldSpec = { tags: ["fold requests", "esmfold2"], summary: "ESMFold2-Fast", description: - "Create structure prediction using ESMFold2-Fast, an inference-optimized\nsingle-sequence variant of ESMFold2 whose folding trunk has half the depth\n(24 vs 48 layers). Folds protein/DNA/RNA/ligand complexes.\n\nUnlike ESMFold2, ESMFold2-Fast is single-sequence only and does not accept\nan MSA (`msa_id`).\n\nArgs:\n - `sequences`: List of chain/molecule entities in the input. Each entry describes a protein, nucleic acid, or ligand, including its sequence, identifier(s), and optional attributes such as SMILES string, CCD code.\n - `smiles` and `ccd` are mutually exclusive for ligands.\n - `diffusion_samples`: Number of diffusion samples to use. Controls how many independent structure samples are generated per input. Default is 1.\n - `num_steps`: Number of sampling steps to use. Sets the number of steps in the diffusion process for each sample. Default is 200.\n - `num_recycles`: Number of recycling steps to use. Determines how many times the model refines its prediction iteratively. Default is 3.\n - `seed`: Random seed for reproducible sampling. `null` lets the system decide.", + "Create structure prediction using ESMFold2-Fast, an inference-optimized\nsingle-sequence variant of ESMFold2 whose folding trunk has half the depth\n(24 vs 48 layers). Folds protein/DNA/RNA/ligand complexes.\n\nUnlike ESMFold2, ESMFold2-Fast is single-sequence only and does not accept\nan MSA (`msa_id`).\n\nArgs:\n - `sequences`: List of chain/molecule entities in the input. Each entry describes a protein, nucleic acid, or ligand, including its sequence, identifier(s), and optional attributes such as SMILES string, CCD code.\n - `smiles` and `ccd` are mutually exclusive for ligands.\n - `diffusion_samples`: Number of diffusion samples to use. Controls how many independent structure samples are generated per input. Default is 1.\n - `num_steps`: Number of sampling steps to use. Sets the number of steps in the diffusion process for each sample. Default is 100.\n - `num_recycles`: Number of recycling steps to use. Determines how many times the model refines its prediction iteratively. Default is 3.\n - `seed`: Random seed for reproducible sampling. `null` lets the system decide.", requestBody: { description: "Request for structure prediction.", content: { @@ -2006,7 +2006,7 @@ const foldSpec = { type: "integer", description: "Number of sampling steps to use.", minimum: 1, - default: 200, + default: 100, }, num_recycles: { type: "integer", @@ -2047,7 +2047,7 @@ const foldSpec = { ], ], diffusion_samples: 1, - num_steps: 200, + num_steps: 100, num_recycles: 3, }, }, @@ -2091,7 +2091,7 @@ const foldSpec = { type: "integer", description: "Number of sampling steps to use.", minimum: 1, - default: 200, + default: 100, }, num_recycles: { type: "integer", @@ -2131,7 +2131,7 @@ const foldSpec = { ], ], diffusion_samples: 1, - num_steps: 200, + num_steps: 100, num_recycles: 3, }, }, diff --git a/source/_static/js/predictorSpec.js b/source/_static/js/predictorSpec.js index f4955fd..6e06180 100644 --- a/source/_static/js/predictorSpec.js +++ b/source/_static/js/predictorSpec.js @@ -1450,7 +1450,15 @@ const predictorSpec = { type: { type: "string", description: "Type of kernel to use with GP.", - enum: ["linear", "rbf", "matern21", "matern32"], + enum: [ + "linear", + "rbf", + "matern12", + "matern32", + "matern52", + "periodic", + "rational_quadratic", + ], example: "rbf", }, multitask: { @@ -1459,6 +1467,20 @@ const predictorSpec = { example: true, default: false, }, + period: { + type: "number", + format: "double", + description: + "Period length for the periodic kernel. Only valid when type is periodic.", + example: 1, + }, + alpha: { + type: "number", + format: "double", + description: + "Scale-mixture parameter for the rational_quadratic kernel; must be > 0. Only valid when type is rational_quadratic.", + example: 1, + }, }, }, TrainRequestGP: { diff --git a/source/_static/js/promptSpec.js b/source/_static/js/promptSpec.js new file mode 100644 index 0000000..d2e009a --- /dev/null +++ b/source/_static/js/promptSpec.js @@ -0,0 +1,1683 @@ +const promptSpec = { + openapi: "3.0.2", + info: { + title: "OpenProtein Prompt", + description: + "# Prompt API\nThe Prompt API provided by OpenProtein.ai allows you to construct and upload prompts to use with our PoET models.\n", + version: "1.0.0", + }, + paths: { + "/api/v1/prompt/create_prompt": { + post: { + tags: ["Prompt"], + summary: "Create a prompt", + description: + "Create a prompt with provided context and query.\n\nThis endpoint accepts a list of files as context.\n", + operationId: "createPrompt", + requestBody: { + required: true, + content: { + "multipart/form-data": { + schema: { + type: "object", + required: ["context"], + properties: { + name: { + type: "string", + }, + description: { + type: "string", + nullable: true, + default: null, + }, + project_uuid: { + type: "string", + format: "uuid", + description: + "Optional project UUID to attach the prompt to.", + }, + context: { + type: "array", + items: { + type: "string", + format: "binary", + }, + description: + "A list of zip files, where the i'th file specifies the data\nfor the i'th context in the prompt. Each zip file may\ncontain: \n - fasta files containing lists of sequences\n - cif structure files\nThe file extensions of the zipped files have to match.\n", + }, + }, + }, + }, + }, + }, + responses: { + 200: { + description: "Prompt created successfully.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/PromptMetadata", + }, + }, + }, + }, + 400: { + description: "Invalid input provided.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 401: { + description: + "Bad or expired token. This can happen if the token is revoked or expired. User should re-authenticate with their credentials.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt": { + get: { + tags: ["Prompt"], + summary: "List prompts", + description: "List prompts available.\n", + operationId: "listPrompts", + parameters: [ + { + name: "project_uuid", + in: "query", + description: "Optional project UUID to filter prompts by.", + required: false, + schema: { + type: "string", + format: "uuid", + }, + }, + { + name: "scope", + in: "query", + description: + "Restrict the listing to the caller's own prompts (`mine`, the\ndefault), platform system prompts (`system`), or both (`all`).", + required: false, + schema: { + type: "string", + enum: ["mine", "system", "all"], + default: "mine", + }, + }, + { + name: "search", + in: "query", + description: + "Case-insensitive substring matched against prompt name and description.", + required: false, + schema: { + type: "string", + }, + }, + { + name: "page_size", + in: "query", + description: "Maximum number of prompts to return.", + required: false, + schema: { + type: "integer", + default: 1024, + }, + }, + { + name: "page_offset", + in: "query", + description: "Number of prompts to skip before returning results.", + required: false, + schema: { + type: "integer", + default: 0, + }, + }, + ], + responses: { + 200: { + description: "List of prompts", + content: { + "application/json": { + schema: { + description: "List of prompts", + type: "array", + items: { + $ref: "#/components/schemas/PromptMetadata", + }, + }, + }, + }, + }, + 401: { + description: + "Bad or expired token. This can happen if the token is revoked or expired. User should re-authenticate with their credentials.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt/query": { + get: { + tags: ["Query"], + summary: "List queries", + description: "List queries available.\n", + operationId: "listQueries", + parameters: [ + { + name: "project_uuid", + in: "query", + description: "Optional project UUID to filter queries by.", + required: false, + schema: { + type: "string", + format: "uuid", + }, + }, + ], + responses: { + 200: { + description: "List of queries", + content: { + "application/json": { + schema: { + description: "List of queries", + type: "array", + items: { + $ref: "#/components/schemas/QueryMetadata", + }, + }, + }, + }, + }, + 401: { + description: + "Bad or expired token. This can happen if the token is revoked or expired. User should re-authenticate with their credentials.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + post: { + tags: ["Query"], + summary: "Create a query", + description: + "Create a query to be used to augment prompts for queries.\n\nThis endpoint accepts a single file as a query.\n", + operationId: "createQuery", + requestBody: { + required: true, + content: { + "multipart/form-data": { + schema: { + type: "object", + required: ["query"], + properties: { + project_uuid: { + type: "string", + format: "uuid", + description: + "Optional project UUID to attach the query to.", + }, + query: { + type: "string", + format: "binary", + description: + "A file specifying the query.\nThe file may be a specify a sequence (fasta) or a\nstructure (cif). The file extension have to match.\n", + }, + }, + }, + }, + }, + }, + responses: { + 200: { + description: "Query created successfully.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/QueryMetadata", + }, + }, + }, + }, + 400: { + description: "Invalid input provided.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 401: { + description: + "Bad or expired token. This can happen if the token is revoked or expired. User should re-authenticate with their credentials.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt/query/{query_id}": { + get: { + tags: ["Query"], + summary: "Get query metadata", + description: "Get metadata of a query.", + parameters: [ + { + name: "query_id", + in: "path", + description: "Query ID to fetch metadata", + required: true, + schema: { + type: "string", + format: "uuid", + }, + }, + ], + operationId: "getQueryMetadata", + responses: { + 200: { + description: "The metadata of the query.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/QueryMetadata", + }, + }, + }, + }, + 401: { + description: + "Bad or expired token. This can happen if the token is revoked or expired. User should re-authenticate with their credentials.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 404: { + description: "Query not found.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + put: { + tags: ["Query"], + summary: "Update query metadata", + description: + "Update the project attachment of a query.\n\nOnly the fields provided in the request body are changed; fields that\nare omitted retain their existing value. Nullable fields may be cleared\nby passing an explicit null value.", + parameters: [ + { + name: "query_id", + in: "path", + description: "Query ID to update", + required: true, + schema: { + type: "string", + format: "uuid", + }, + }, + ], + operationId: "updateQuery", + requestBody: { + description: "Fields to update on the query.", + required: true, + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/QueryUpdate", + }, + }, + }, + }, + responses: { + 200: { + description: "The updated query metadata.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/QueryMetadata", + }, + }, + }, + }, + 400: { + description: "Invalid input provided.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 401: { + description: + "Bad or expired token. This can happen if the token is revoked or expired. User should re-authenticate with their credentials.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 404: { + description: "Query not found.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt/query/{query_id}/content": { + get: { + tags: ["Query"], + summary: "Get query content", + description: + "Get content of query by downloading the uploaded query file.", + parameters: [ + { + name: "query_id", + in: "path", + description: "Query ID to fetch", + required: true, + schema: { + type: "string", + format: "uuid", + }, + }, + ], + operationId: "getQuery", + responses: { + 200: { + description: + "The query file in either fasta or cif format depending on whether a sequence or structure was uploaded.", + content: { + "text/x-fasta": { + schema: { + type: "string", + format: "binary", + example: "", + }, + }, + "chemical/x-mmcif": { + schema: { + type: "string", + format: "binary", + example: "", + }, + }, + }, + }, + 401: { + description: + "Bad or expired token. This can happen if the token is revoked or expired. User should re-authenticate with their credentials.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 404: { + description: "Query not found.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt/{prompt_id}": { + get: { + tags: ["Prompt"], + summary: "Get prompt metadata", + description: "Get metadata of a prompt.", + parameters: [ + { + name: "prompt_id", + in: "path", + description: "Prompt ID to fetch metadata", + required: true, + schema: { + type: "string", + format: "uuid", + }, + }, + ], + operationId: "getPromptMetadata", + responses: { + 200: { + description: "The metadata of the prompt.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/PromptMetadata", + }, + }, + }, + }, + 401: { + description: + "Bad or expired token. This can happen if the token is revoked or expired. User should re-authenticate with their credentials.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 404: { + description: "Prompt not found.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + put: { + tags: ["Prompt"], + summary: "Update prompt metadata", + description: + "Update the name, description, or project attachment of a prompt.\n\nOnly the fields provided in the request body are changed; fields that\nare omitted retain their existing value. Nullable fields may be cleared\nby passing an explicit null value.", + parameters: [ + { + name: "prompt_id", + in: "path", + description: "Prompt ID to update", + required: true, + schema: { + type: "string", + format: "uuid", + }, + }, + ], + operationId: "updatePrompt", + requestBody: { + description: "Fields to update on the prompt.", + required: true, + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/PromptUpdate", + }, + }, + }, + }, + responses: { + 200: { + description: "The updated prompt metadata.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/PromptMetadata", + }, + }, + }, + }, + 400: { + description: "Invalid input provided.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 401: { + description: + "Bad or expired token. This can happen if the token is revoked or expired. User should re-authenticate with their credentials.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 403: { + description: + "The target prompt is a platform system prompt and cannot be modified.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 404: { + description: "Prompt not found.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt/{prompt_id}/content": { + get: { + tags: ["Prompt"], + summary: "Get prompt content", + description: + "Get content of prompt by downloading the uploaded context files in a single zip.", + parameters: [ + { + name: "prompt_id", + in: "path", + description: "Prompt ID to fetch", + required: true, + schema: { + type: "string", + format: "uuid", + }, + }, + ], + operationId: "getPrompt", + responses: { + 200: { + description: + "The prompt containing the context files in a zip file.", + content: { + "application/zip": { + schema: { + type: "string", + format: "binary", + example: "", + }, + }, + }, + }, + 401: { + description: + "Bad or expired token. This can happen if the token is revoked or expired. User should re-authenticate with their credentials.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 404: { + description: "Prompt not found.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt/edit_protein": { + post: { + tags: ["Structure"], + summary: "Edit protein structure", + description: + 'Edit a Protein object by specifying aligned reference and new sequences, and a structure mask.\nHandles insertions, deletions, point mutations, and structure masking.\n\n**Advanced Multi-File Support:**\nInstead of passing a single `protein` file, you may supply multiple files into the `structures` array\nand provide a `config` JSON string to control how they are edited and grouped. By using `config`,\nyou can:\n- Construct 3D rigid bodies (groups) from multiple disparate chains.\n- Introduce sequence-only chains.\n- Rename chain IDs dynamically to avoid collisions natively.\n- Apply unique sequences, structure masks, binding tracks, and pLDDT overrides to any chains within the group structure.\n\nExample `config` JSON payload:\n```json\n{\n "groups": [\n {\n "structures": [\n {\n "file_index": 0,\n "chain_ids": {"A": "X", "B": "Y"},\n "edits": {\n "X": {\n "reference_sequence": "ACDEFG",\n "new_sequence": "ACHEFG",\n "structure_mask": "SSXSSS",\n "binding": "UUBUUU",\n "plddt": 72.5\n }\n }\n }\n ],\n "sequences": [\n {\n "sequence": "ACDEF",\n "chain_id": "Z"\n }\n ]\n }\n ]\n}\n```\n\n**Config Field Details:**\n- **`groups`**: An array where each item defines a rigid-body group. All structures and sequences within the same group will have their relative positions fixed.\n- **`file_index`**: The integer index of the file in the `structures` array. `0` refers to the first file uploaded.\n- **`chain_ids` (optional)**: Renames chains from the input structure. A mapping of `{"original_id": "new_id"}`.\n If provided, this acts as an **explicit inclusion list**: only chains mapped here will be extracted.\n Unmapped chains are ignored. Map a chain to itself (e.g., `{"A": "A"}`) to keep it without renaming.\n- **`edits` (optional)**: Specifies modifications to be applied to specific chains (by their assigned ID). Each chain edit can describe all residue-level outputs for that chain:\n - **Sequence edit** via `reference_sequence` and `new_sequence`\n - **Structure edit** via `structure_mask`\n - **Binding edit** via `binding`, an aligned string using `B` (binding), `N` (not binding), `U` (unknown), and `-` (deleted / no residue)\n - **pLDDT override** via `plddt`, a scalar from `0` to `100` applied to final residues with known CA coordinates. Residues without structure keep `NaN`.\n- **`sequences`**: Used to supply sequence-only protein chains directly as strings without a structure file.\n\nLegacy single-file usage (via `protein`, `reference_sequence`, `new_sequence`, and `structure_mask`) remains fully supported if `config` and `structures` are omitted.\n', + operationId: "editProteinStructure", + requestBody: { + required: true, + content: { + "multipart/form-data": { + schema: { + type: "object", + properties: { + protein: { + type: "string", + format: "binary", + description: "CIF file containing the protein structure.", + }, + reference_sequence: { + type: "string", + description: 'Reference sequence (may include "-").', + }, + new_sequence: { + type: "string", + description: 'New sequence (may include "-").', + }, + structure_mask: { + type: "string", + description: 'String of "S" and "X" for structure masking.', + }, + structures: { + type: "array", + items: { + type: "string", + format: "binary", + }, + description: + "Array of CIF or PDB files containing protein structures.", + }, + config: { + description: "Configuration for groups and edits.", + allOf: [ + { + $ref: "#/components/schemas/EditProteinConfig", + }, + ], + }, + }, + }, + }, + }, + }, + responses: { + 200: { + description: "Edited protein CIF file", + content: { + "chemical/x-mmcif": { + schema: { + type: "string", + format: "binary", + }, + }, + }, + }, + 400: { + description: "Invalid input", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 401: { + description: "Unauthorized", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt/extract_chain": { + post: { + tags: ["Structure"], + summary: "Extract chain", + description: "Extract chain from protein complex.\n", + operationId: "extractChain", + requestBody: { + required: true, + content: { + "multipart/form-data": { + schema: { + type: "object", + properties: { + protein: { + type: "string", + format: "binary", + description: "CIF file containing the protein complex.", + }, + chain_id: { + type: "string", + description: "Chain ID to extract from protein file.", + }, + use_bfactor_as_plddt: { + type: "boolean", + description: "Use bfactor as pLDDT.", + }, + }, + required: ["protein", "chain_id", "use_bfactor_as_plddt"], + }, + }, + }, + }, + responses: { + 200: { + description: "Extracted protein as CIF file.", + content: { + "chemical/x-mmcif": { + schema: { + type: "string", + format: "binary", + }, + }, + }, + }, + 400: { + description: "Invalid input", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 401: { + description: "Unauthorized", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt/normalize_structure": { + post: { + tags: ["Structure"], + summary: "Normalize a protein structure file", + description: + "Normalize a protein structure by converting it into standardized CIF format.\nSupports input in both PDB and CIF formats.", + operationId: "normalizeStructure", + requestBody: { + required: true, + content: { + "multipart/form-data": { + schema: { + type: "object", + required: ["protein"], + properties: { + protein: { + type: "string", + format: "binary", + description: "Protein structure file in PDB or CIF format.", + }, + plddt: { + type: "string", + description: + "Optional scalar pLDDT override applied to all atoms in the normalized CIF output. Provide a number between 0 and 100 inclusive.", + }, + }, + }, + }, + }, + }, + responses: { + 200: { + description: "Normalized protein CIF file.", + content: { + "chemical/x-mmcif": { + schema: { + type: "string", + format: "binary", + }, + }, + }, + }, + 400: { + description: "Invalid input", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 401: { + description: "Unauthorized", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt/sequence_align_batch": { + post: { + tags: ["Align"], + summary: + "Batch sequence alignment and identity computation (Streaming)", + description: + "Align the query sequence against each target sequence using pairwise alignment\nand compute sequence identity.\n\n**Streaming Endpoint:** Returns a stream of JSON objects (NDJSON), where each line\ncorresponds to one target sequence in the order provided.", + operationId: "sequenceAlignBatch", + requestBody: { + required: true, + content: { + "application/json": { + schema: { + type: "object", + required: ["query_sequence", "target_sequences"], + properties: { + query_sequence: { + type: "string", + description: + "Query protein sequence (single-letter amino acid codes).\nUse `:` to separate chains of a multichain query; target sequences\nmust then have the same number of chains, aligned chain-by-position.", + }, + target_sequences: { + type: "array", + items: { + type: "string", + }, + description: + "List of target protein sequences. Each entry may be multichain\nusing `:` separators; its chain count must match the query.", + }, + return_alignment: { + type: "boolean", + description: + "Whether to return aligned query and target sequences as tuples.", + default: false, + }, + }, + }, + example: { + query_sequence: "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ", + target_sequences: [ + "MKTAYIAKQRQISFVKSHFSRQLDERLGLIEVQ", + "ARNMKTAYIAKQRQISYVKSHFSRQLDERLGLIEVQ", + ], + return_alignment: true, + }, + }, + }, + }, + responses: { + 200: { + description: + "Stream of sequence identities (and optionally alignments).\nEach line is a JSON object representing the result for a single target.", + content: { + "application/x-ndjson": { + schema: { + type: "object", + properties: { + identity: { + type: "number", + format: "float", + description: + "Sequence identity for this target, normalized to alignment length (0-1).", + }, + alignment: { + type: "array", + items: { + type: "string", + }, + description: + "Tuple of (aligned_query_sequence, aligned_target_sequence).\nFor multichain inputs, chains are joined with `:` within each\naligned string in the same order as the query chains.\nPresent if `return_alignment=true`.", + }, + }, + example: { + identity: 0.97, + alignment: [ + "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ", + "MKTAYIAKQRQISFVKSHFSRQLDERLGLIEVQ", + ], + }, + }, + }, + }, + }, + 400: { + description: "Invalid input provided.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 401: { + description: "Unauthorized.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt/structure_align_batch_by_id": { + post: { + tags: ["Align"], + summary: "Batch structure alignment using specified method (Streaming)", + description: + "Perform structure-based alignment between query structures and targets.\n\nExactly one of `protein` or `design_id` must be provided as the query.\nWhen `design_id` is given, it references a fold job with N design\nstructures, and `targets_id` must contain a positive multiple of N\nstructures. Design `i` is aligned against `targets[i*k : (i+1)*k]`\nwhere `k = len(targets) / len(designs)`. Each result row carries a\n`design_index` (0-indexed) so callers can regroup the stream.\n\n**Streaming Endpoint:** Returns a stream of JSON objects (NDJSON), where each line\ncorresponds to one (query, target) pair.", + operationId: "structureAlignBatchById", + requestBody: { + required: true, + content: { + "multipart/form-data": { + schema: { + type: "object", + required: [ + "targets_id", + "method", + "return_transform", + "return_alignment", + "return_identities", + "return_plddt", + ], + properties: { + protein: { + type: "string", + format: "binary", + description: + "CIF or PDB file containing the query structure. All protein\nchains in the file are used; non-protein chains are filtered\nor rejected per the service's `REJECT_NON_PROTEIN_CHAINS`\nsetting. Targets must have matching chain ids.\nMutually exclusive with `design_id`; exactly one of the two\nmust be provided.", + }, + design_id: { + type: "string", + format: "uuid", + description: + "Fold job ID referencing a **collection** of N query\nstructures (e.g. designs from RFdiffusion or BoltzGen).\nWhen provided, `targets_id` must contain N*k structures\nand design `i` is aligned against `targets[i*k:(i+1)*k]`.\nMutually exclusive with `protein`; exactly one of the two\nmust be provided.", + }, + targets_id: { + type: "string", + format: "uuid", + description: + "Target ID referencing a **collection** of structures to align against.", + }, + method: { + type: "string", + description: + 'The alignment method to use. Supported values are "kabsch", "nwalign", and "tmalign".', + default: "tmalign", + }, + return_transform: { + type: "boolean", + description: + "Whether to return 3x3 rotation matrices and 3x1 translation vectors.", + default: false, + }, + return_alignment: { + type: "boolean", + description: + "Whether to return aligned query and target sequences as tuples.", + default: false, + }, + return_identities: { + type: "boolean", + description: + "Whether to return sequence identities normalized to alignment length (0-1).", + default: false, + }, + return_plddt: { + type: "boolean", + description: "Whether to return mean pLDDT per target.", + default: false, + }, + }, + }, + example: { + protein: "", + targets_id: "1dfcb748-0f66-4cd0-9fbf-6c5b0da32512", + method: "tmalign", + return_transform: true, + return_alignment: false, + return_identities: true, + return_plddt: true, + }, + }, + }, + }, + responses: { + 200: { + description: + "Stream of structure alignment results.\nEach line is a JSON object representing the result for a single target.", + content: { + "application/x-ndjson": { + schema: { + type: "object", + properties: { + tmscore: { + type: "number", + format: "float", + description: "TM-score for this target structure.", + }, + rmsd: { + type: "number", + format: "float", + description: "RMSD for this target structure.", + }, + identity: { + type: "number", + format: "float", + description: + "Sequence identity for this target, normalized to alignment length (0-1).\nPresent if `return_identities=true`.", + }, + R: { + type: "array", + items: { + type: "array", + items: { + type: "number", + format: "float", + }, + }, + description: + "3x3 rotation matrix for this target (present if `return_transform=true`).", + }, + t: { + type: "array", + items: { + type: "number", + format: "float", + }, + description: + "3x1 translation vector for this target (present if `return_transform=true`).", + }, + alignment: { + type: "array", + items: { + type: "string", + }, + description: + "Tuple of (aligned_query_sequence, aligned_target_sequence).\nFor multichain inputs, chains are joined with `:` in the\norder of the query chain ids.\nPresent if `return_alignment=true`.", + }, + plddt: { + type: "number", + format: "float", + description: + "Mean pLDDT for this target, averaged across all chains\n(NaN residues excluded). Present if `return_plddt=true`.", + }, + design_index: { + type: "integer", + description: + "0-indexed position of the query design within `design_id`.\nPresent only when `design_id` was provided in the request;\nomitted when the request used an uploaded `protein`.", + }, + }, + example: { + tmscore: 0.89, + rmsd: 1.82, + identity: 0.95, + R: [ + [0.998, -0.015, 0.062], + [0.017, 0.999, -0.041], + [-0.061, 0.042, 0.997], + ], + t: [1.23, -0.45, 0.12], + plddt: 87.3, + design_index: 0, + }, + }, + }, + }, + }, + 400: { + description: "Invalid input provided.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 401: { + description: "Unauthorized.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + "/api/v1/prompt/plddt_batch_by_id": { + get: { + tags: ["Structure"], + summary: "Get mean pLDDT for all structures in targets_id (Streaming)", + description: + "Retrieve the mean pLDDT scores for all structures contained within the collection\nidentified by `targets_id`.\n\n**Streaming Endpoint:** Returns a stream of JSON objects (NDJSON).", + operationId: "getPlddtBatchById", + parameters: [ + { + name: "targets_id", + in: "query", + description: + "Target ID referencing a **collection** of structures.", + required: true, + schema: { + type: "string", + format: "uuid", + }, + }, + ], + responses: { + 200: { + description: "Stream of pLDDT scores.", + content: { + "application/x-ndjson": { + schema: { + type: "object", + properties: { + plddt: { + type: "number", + format: "float", + description: + "Mean pLDDT for a single target structure, averaged across\nall chains (NaN residues excluded).", + }, + }, + example: { + plddt: 87.3, + }, + }, + }, + }, + }, + 400: { + description: "Invalid input provided.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 401: { + description: "Unauthorized.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + 404: { + description: "Targets ID not found.", + content: { + "application/json": { + schema: { + $ref: "#/components/schemas/Error", + }, + }, + }, + }, + }, + security: [ + { + oauth2: [], + }, + ], + }, + }, + }, + components: { + securitySchemes: { + oauth2: { + type: "oauth2", + flows: { + password: { + tokenUrl: "/api/v1/auth/login", + scopes: {}, + }, + }, + }, + }, + schemas: { + PromptMetadata: { + title: "PromptMetadata", + description: + "The metadata of a prompt entity containing sequences and/or structures as context and an optional query used to condition PoET models.", + type: "object", + required: [ + "id", + "name", + "description", + "created_date", + "num_replicates", + "job_id", + "status", + "project_uuid", + ], + properties: { + id: { + type: "string", + format: "uuid", + description: "Prompt unique identifier.", + }, + name: { + type: "string", + description: "Name of the prompt", + example: "My Awesome Prompt", + }, + description: { + type: "string", + description: "Description of the prompt", + example: "Prompt for use with top secret project.", + nullable: true, + }, + created_date: { + type: "string", + format: "date-time", + description: "The date the prompt was created.", + }, + num_replicates: { + type: "integer", + description: "Number of replicates provided as context.", + }, + job_id: { + type: "string", + format: "uuid", + description: "Job ID of any associated job for the prompt.", + nullable: true, + }, + status: { + type: "string", + description: "Status of the prompt.", + }, + project_uuid: { + type: "string", + format: "uuid", + description: "Project this prompt is attached to.", + nullable: true, + }, + sequence_length: { + title: "Sequence Length", + description: + "Length of the prompt's context chains. Set when every chain across\nevery Complex across every replicate has the same length; null when\nchain lengths vary or no context has been parsed yet.", + type: "integer", + nullable: true, + }, + is_system: { + type: "boolean", + default: false, + description: + "True for platform-curated system prompts available to every user.\nSystem prompts are read-only over the HTTP API; users cannot create,\nmodify, or delete them. False or absent for user-uploaded prompts.", + }, + }, + }, + Error: { + title: "Error", + description: "A error object providing details of the error.", + required: ["detail"], + type: "object", + properties: { + detail: { + title: "Detail", + type: "string", + }, + }, + }, + QueryMetadata: { + title: "QueryMetadata", + description: + "The metadata of a query entity containing the sequence and/or structure used as a query to condition PoET2 models.", + type: "object", + required: ["id", "name", "created_date", "project_uuid"], + properties: { + id: { + type: "string", + format: "uuid", + description: "Query unique identifier.", + }, + name: { + type: "string", + description: + "Display name of the query. Defaults to the query's UUID string when the\nuser has not set a name explicitly; clearing the name via PUT (passing\n`null` to `QueryUpdate.name`) resets it to this default.", + example: "My Awesome Query", + }, + created_date: { + type: "string", + format: "date-time", + description: "The date the query was created.", + }, + project_uuid: { + type: "string", + format: "uuid", + description: "Project this query is attached to.", + nullable: true, + }, + sequence_length: { + title: "Sequence Length", + description: + "Length of the query's protein chain(s). Set when every chain in the\nquery has the same length; null when chains differ in length.", + type: "integer", + nullable: true, + }, + }, + }, + QueryUpdate: { + title: "QueryUpdate", + description: + "Fields to update on a query. Omitted fields are left unchanged; fields\nprovided with an explicit null value (for nullable fields) are cleared.", + type: "object", + properties: { + name: { + type: "string", + description: "Name of the query.", + example: "My Awesome Query", + nullable: true, + }, + project_uuid: { + type: "string", + format: "uuid", + description: "Project to attach the query to.", + nullable: true, + }, + }, + }, + PromptUpdate: { + title: "PromptUpdate", + description: + "Fields to update on a prompt. Omitted fields are left unchanged; fields\nprovided with an explicit null value (for nullable fields) are cleared.", + type: "object", + properties: { + name: { + type: "string", + description: "Name of the prompt.", + example: "My Awesome Prompt", + }, + description: { + type: "string", + description: "Description of the prompt.", + example: "Prompt for use with top secret project.", + nullable: true, + }, + project_uuid: { + type: "string", + format: "uuid", + description: "Project to attach the prompt to.", + nullable: true, + }, + }, + }, + EditProteinChainEditConfig: { + title: "EditProteinChainEditConfig", + type: "object", + properties: { + reference_sequence: { + type: "string", + }, + new_sequence: { + type: "string", + }, + structure_mask: { + type: "string", + }, + binding: { + type: "string", + description: + "Optional aligned binding track for the edited chain, in addition to sequence and structure edits. Uses `B` (binding), `N` (not binding), `U` (unknown), and `-` (deleted / no residue).", + }, + plddt: { + type: "number", + minimum: 0, + maximum: 100, + description: + "Optional scalar pLDDT override for the final edited chain. Applied only at residues with known CA coordinates; residues without structure keep NaN.", + }, + }, + }, + EditProteinStructureConfig: { + title: "EditProteinStructureConfig", + type: "object", + properties: { + file_index: { + type: "integer", + description: "Index of the file in the uploaded structures array.", + }, + chain_ids: { + type: "object", + additionalProperties: { + type: "string", + }, + description: "Mapping of original chain IDs to new chain IDs.", + example: { + A: "X", + B: "Y", + }, + }, + edits: { + type: "object", + additionalProperties: { + $ref: "#/components/schemas/EditProteinChainEditConfig", + }, + description: + "Edits to apply to the chains (keyed by the assigned chain ID).", + example: { + X: { + reference_sequence: "ACDEFG", + new_sequence: "ACHEFG", + structure_mask: "SSXSSS", + binding: "UUBUUU", + }, + }, + }, + }, + }, + EditProteinSequenceConfig: { + title: "EditProteinSequenceConfig", + type: "object", + properties: { + sequence: { + type: "string", + }, + chain_id: { + type: "string", + }, + }, + }, + EditProteinGroup: { + title: "EditProteinGroup", + type: "object", + properties: { + structures: { + type: "array", + items: { + $ref: "#/components/schemas/EditProteinStructureConfig", + }, + }, + sequences: { + type: "array", + items: { + $ref: "#/components/schemas/EditProteinSequenceConfig", + }, + }, + }, + }, + EditProteinConfig: { + title: "EditProteinConfig", + description: + "Configuration for editing and combining multiple protein chains.", + type: "object", + properties: { + groups: { + type: "array", + items: { + $ref: "#/components/schemas/EditProteinGroup", + }, + }, + }, + example: { + groups: [ + { + structures: [ + { + file_index: 0, + chain_ids: { + A: "X", + B: "Y", + }, + edits: { + X: { + reference_sequence: "ACDEFG", + new_sequence: "ACHEFG", + structure_mask: "SSXSSS", + binding: "UUBUUU", + plddt: 72.5, + }, + }, + }, + ], + sequences: [ + { + sequence: "MKL", + chain_id: "Z", + }, + ], + }, + ], + }, + }, + }, + }, + tags: [ + { + name: "Prompt", + description: "Prompt _context_ upload, get, and list operations.", + }, + { + name: "Query", + description: "Prompt _query_ upload, get, and list operations.", + }, + { + name: "Structure", + description: "Structure editing and normalization operations.", + }, + { + name: "Align", + description: "Structure and sequence alignment operations.", + }, + ], +}; +export default promptSpec;